Lineage for d2pl6b_ (2pl6 B:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1336145Fold b.138: Hydrophobin II, HfbII [101750] (1 superfamily)
    core: barrel, closed; n=4, S=8; complex topology; helix-containing crossover connection
  4. 1336146Superfamily b.138.1: Hydrophobin II, HfbII [101751] (1 family) (S)
    automatically mapped to Pfam PF06766
  5. 1336147Family b.138.1.1: Hydrophobin II, HfbII [101752] (2 proteins)
    a self-assembling amphiphile
  6. 1336148Protein Hydrophobin II, HfbII [101753] (1 species)
  7. 1336149Species Trichoderma reesei [TaxId:51453] [101754] (5 PDB entries)
  8. 1336159Domain d2pl6b_: 2pl6 B: [149613]
    automated match to d1r2ma_
    complexed with htg

Details for d2pl6b_

PDB Entry: 2pl6 (more details), 2.2 Å

PDB Description: monoclinic crystal structure of hydrophobin hfbii in presence of a detergent
PDB Compounds: (B:) Hydrophobin-2

SCOPe Domain Sequences for d2pl6b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pl6b_ b.138.1.1 (B:) Hydrophobin II, HfbII {Trichoderma reesei [TaxId: 51453]}
avcptglfsnplccatnvldligvdcktptiavdtgaifqahcaskgskplccvapvadq
allcqkaigtf

SCOPe Domain Coordinates for d2pl6b_:

Click to download the PDB-style file with coordinates for d2pl6b_.
(The format of our PDB-style files is described here.)

Timeline for d2pl6b_: