SCOPe 2.06: Domain d2pkyx_: 2pky X:

Lineage for d2pkyx_ (2pky X:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.8: Haloalkane dehalogenase [53513] (2 proteins)

6. Protein Haloalkane dehalogenase [53514] (4 species)

7. Species Xanthobacter autotrophicus [TaxId:280] [53515] (17 PDB entries)

8. Domain d2pkyx_: 2pky X: [149608]
   automated match to d1b6ga_

Details for d2pkyx_

PDB Entry: 2pky, 1.55 Å

PDB Description: The Effect of Deuteration on Protein Structure A High Resolution Comparison of Hydrogenous and Perdeuterated Haloalkane Dehalogenase

PDB Compounds: (X:) haloalkane dehalogenase

SCOPe Domain Sequences for d2pkyx_:

Sequence; same for both SEQRES and ATOM records:

>d2pkyx_ c.69.1.8 (X:) Haloalkane dehalogenase {Xanthobacter autotrophicus [TaxId: 280]}
inairtpdqrfsnldqypfspnylddlpgypglrahyldegnsdaedvflclhgeptwsy
lyrkmipvfaesgarviapdffgfgksdkpvdeedytfefhrnfllalierldlrnitlv
vqdwggflgltlpmadpsrfkrliimnaclmtdpvtqpafsafvtqpadgftawkydlvt
psdlrldqfmkrwaptlteaeasayaapfpdtsyqagvrkfpkmvaqrdqacidisteai
sfwqndwngqtfmaigmkdkllgpdvmypmkalingcpepleiadaghfvqefgeqvare
alkhfaet

Timeline for d2pkyx_:

• d2pkyx_ first appeared in SCOP 1.75, called d2pkyx1
  
• d2pkyx_ appears in SCOPe 2.05
  
• d2pkyx_ appears in SCOPe 2.07
  
• d2pkyx_ appears in the current release, SCOPe 2.08