Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.190: Chorismate lyase-like [64287] (1 superfamily) duplication of alpha(2)-beta(3) motif; antiparallel beta sheet, order 123654 |
Superfamily d.190.1: Chorismate lyase-like [64288] (4 families) |
Family d.190.1.2: UTRA domain [143473] (11 proteins) Pfam PF07702 |
Protein Histidine utilization repressor HutC [160399] (1 species) |
Species Pseudomonas syringae pv. tomato [TaxId:323] [160400] (1 PDB entry) Uniprot Q87UX0 109-249 |
Domain d2pkhg_: 2pkh G: [149602] automated match to d2pkha1 complexed with edo |
PDB Entry: 2pkh (more details), 1.95 Å
SCOPe Domain Sequences for d2pkhg_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2pkhg_ d.190.1.2 (G:) Histidine utilization repressor HutC {Pseudomonas syringae pv. tomato [TaxId: 323]} rhtckvmvlkeeaagseralaldmregqrvfhslivhfendipvqiedrfvnaqvapdyl kqdftlqtpyaylsqvapltegehvveailaeadeckllqidagepcllirrrtwsgrqp vtaarlihpgsrhrlegrftk
Timeline for d2pkhg_: