Lineage for d2pkhf1 (2pkh F:109-249)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 879760Fold d.190: Chorismate lyase-like [64287] (1 superfamily)
    duplication of alpha(2)-beta(3) motif; antiparallel beta sheet, order 123654
  4. 879761Superfamily d.190.1: Chorismate lyase-like [64288] (3 families) (S)
  5. 879776Family d.190.1.2: UTRA domain [143473] (10 proteins)
    Pfam PF07702
  6. 879777Protein Histidine utilization repressor HutC [160399] (1 species)
  7. 879778Species Pseudomonas syringae pv. tomato [TaxId:323] [160400] (1 PDB entry)
    Uniprot Q87UX0 109-249
  8. 879784Domain d2pkhf1: 2pkh F:109-249 [149601]
    automatically matched to 2PKH A:109-249
    complexed with edo

Details for d2pkhf1

PDB Entry: 2pkh (more details), 1.95 Å

PDB Description: Structural Genomics, the crystal structure of the C-terminal domain of histidine utilization repressor from Pseudomonas syringae pv. tomato str. DC3000
PDB Compounds: (F:) Histidine utilization repressor

SCOP Domain Sequences for d2pkhf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pkhf1 d.190.1.2 (F:109-249) Histidine utilization repressor HutC {Pseudomonas syringae pv. tomato [TaxId: 323]}
rhtckvmvlkeeaagseralaldmregqrvfhslivhfendipvqiedrfvnaqvapdyl
kqdftlqtpyaylsqvapltegehvveailaeadeckllqidagepcllirrrtwsgrqp
vtaarlihpgsrhrlegrftk

SCOP Domain Coordinates for d2pkhf1:

Click to download the PDB-style file with coordinates for d2pkhf1.
(The format of our PDB-style files is described here.)

Timeline for d2pkhf1: