Lineage for d2pkhe_ (2pkh E:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1228510Fold d.190: Chorismate lyase-like [64287] (1 superfamily)
    duplication of alpha(2)-beta(3) motif; antiparallel beta sheet, order 123654
  4. 1228511Superfamily d.190.1: Chorismate lyase-like [64288] (4 families) (S)
  5. 1228526Family d.190.1.2: UTRA domain [143473] (11 proteins)
    Pfam PF07702
  6. 1228527Protein Histidine utilization repressor HutC [160399] (1 species)
  7. 1228528Species Pseudomonas syringae pv. tomato [TaxId:323] [160400] (1 PDB entry)
    Uniprot Q87UX0 109-249
  8. 1228533Domain d2pkhe_: 2pkh E: [149600]
    automated match to d2pkha1
    complexed with edo

Details for d2pkhe_

PDB Entry: 2pkh (more details), 1.95 Å

PDB Description: Structural Genomics, the crystal structure of the C-terminal domain of histidine utilization repressor from Pseudomonas syringae pv. tomato str. DC3000
PDB Compounds: (E:) Histidine utilization repressor

SCOPe Domain Sequences for d2pkhe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pkhe_ d.190.1.2 (E:) Histidine utilization repressor HutC {Pseudomonas syringae pv. tomato [TaxId: 323]}
hrhtckvmvlkeeaagseralaldmregqrvfhslivhfendipvqiedrfvnaqvapdy
lkqdftlqtpyaylsqvapltegehvveailaeadeckllqidagepcllirrrtwsgrq
pvtaarlihpgsrhrlegrftk

SCOPe Domain Coordinates for d2pkhe_:

Click to download the PDB-style file with coordinates for d2pkhe_.
(The format of our PDB-style files is described here.)

Timeline for d2pkhe_: