![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.190: Chorismate lyase-like [64287] (1 superfamily) duplication of alpha(2)-beta(3) motif; antiparallel beta sheet, order 123654 |
![]() | Superfamily d.190.1: Chorismate lyase-like [64288] (4 families) ![]() |
![]() | Family d.190.1.2: UTRA domain [143473] (11 proteins) Pfam PF07702 |
![]() | Protein Histidine utilization repressor HutC [160399] (1 species) |
![]() | Species Pseudomonas syringae pv. tomato [TaxId:323] [160400] (1 PDB entry) Uniprot Q87UX0 109-249 |
![]() | Domain d2pkhc_: 2pkh C: [149598] automated match to d2pkha1 complexed with edo |
PDB Entry: 2pkh (more details), 1.95 Å
SCOPe Domain Sequences for d2pkhc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2pkhc_ d.190.1.2 (C:) Histidine utilization repressor HutC {Pseudomonas syringae pv. tomato [TaxId: 323]} hrhtckvmvlkeeaagseralaldmregqrvfhslivhfendipvqiedrfvnaqvapdy lkqdftlqtpyaylsqvapltegehvveailaeadeckllqidagepcllirrrtwsgrq pvtaarlihpgsrhrlegrftk
Timeline for d2pkhc_: