SCOP 1.75: Domain d2pk2c2: 2pk2 C:8-150

Lineage for d2pk2c2 (2pk2 C:8-150)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.74: Cyclin-like [47953] (1 superfamily)
   core: 5 helices; one helix is surrounded by the others

4. Superfamily a.74.1: Cyclin-like [47954] (3 families)
   duplication: consists of two domains of this fold

5. Family a.74.1.1: Cyclin [47955] (8 proteins)

6. Protein Cyclin T1 [158595] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [158596] (4 PDB entries)
   Uniprot O60563 151-259! Uniprot O60563 151-263! Uniprot O60563 5-150! Uniprot O60563 8-150

8. Domain d2pk2c2: 2pk2 C:8-150 [149591]
   automatically matched to 2PK2 A:8-150

Details for d2pk2c2

PDB Entry: 2pk2, 2.67 Å

PDB Description: cyclin box structure of the p-tefb subunit cyclin t1 derived from a fusion complex with eiav tat

PDB Compounds: (C:) Cyclin-T1, Protein Tat

SCOP Domain Sequences for d2pk2c2:

Sequence; same for both SEQRES and ATOM records:

>d2pk2c2 a.74.1.1 (C:8-150) Cyclin T1 {Human (Homo sapiens) [TaxId: 9606]}
nnkrwyftreqlenspsrrfgvdpdkelsyrqqaanllqdmgqrlnvsqltintaivymh
rfymiqsftrfpgnsvapaalflaakveeqpkklehvikvahtclhpqeslpdtrseayl
qqvqdlvilesiilqtlgfelti

Timeline for d2pk2c2:

• d2pk2c2 is new in SCOP 1.75
  
• d2pk2c2 appears in SCOPe 2.01
  
• d2pk2c2 appears in the current release, SCOPe 2.08