Lineage for d2pk2c1 (2pk2 C:151-263)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 772181Fold a.74: Cyclin-like [47953] (1 superfamily)
    core: 5 helices; one helix is surrounded by the others
  4. 772182Superfamily a.74.1: Cyclin-like [47954] (3 families) (S)
    duplication: consists of two domains of this fold
  5. 772183Family a.74.1.1: Cyclin [47955] (8 proteins)
  6. 772443Protein Cyclin T1 [158595] (1 species)
  7. 772444Species Human (Homo sapiens) [TaxId:9606] [158596] (4 PDB entries)
    Uniprot O60563 151-259! Uniprot O60563 151-263! Uniprot O60563 5-150! Uniprot O60563 8-150
  8. 772455Domain d2pk2c1: 2pk2 C:151-263 [149590]
    automatically matched to 2PK2 A:151-263

Details for d2pk2c1

PDB Entry: 2pk2 (more details), 2.67 Å

PDB Description: cyclin box structure of the p-tefb subunit cyclin t1 derived from a fusion complex with eiav tat
PDB Compounds: (C:) Cyclin-T1, Protein Tat

SCOP Domain Sequences for d2pk2c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pk2c1 a.74.1.1 (C:151-263) Cyclin T1 {Human (Homo sapiens) [TaxId: 9606]}
dhphthvvkctqlvraskdlaqtsyfmatnslhlttfslqytppvvacvcihlackwsnw
eipvstdgkhwweyvdatvtlelldeltheflqilektpnrlkriwnwracea

SCOP Domain Coordinates for d2pk2c1:

Click to download the PDB-style file with coordinates for d2pk2c1.
(The format of our PDB-style files is described here.)

Timeline for d2pk2c1: