Lineage for d2pk2b1 (2pk2 B:151-263)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2718075Fold a.74: Cyclin-like [47953] (1 superfamily)
    core: 5 helices; one helix is surrounded by the others
  4. 2718076Superfamily a.74.1: Cyclin-like [47954] (4 families) (S)
    duplication: consists of two domains of this fold
  5. 2718077Family a.74.1.1: Cyclin [47955] (9 proteins)
  6. 2718483Protein Cyclin T1 [158595] (1 species)
  7. 2718484Species Human (Homo sapiens) [TaxId:9606] [158596] (10 PDB entries)
    Uniprot O60563 151-259! Uniprot O60563 151-263! Uniprot O60563 5-150! Uniprot O60563 8-150
  8. 2718505Domain d2pk2b1: 2pk2 B:151-263 [149588]
    automatically matched to 2PK2 A:151-263

Details for d2pk2b1

PDB Entry: 2pk2 (more details), 2.67 Å

PDB Description: cyclin box structure of the p-tefb subunit cyclin t1 derived from a fusion complex with eiav tat
PDB Compounds: (B:) Cyclin-T1, Protein Tat

SCOPe Domain Sequences for d2pk2b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pk2b1 a.74.1.1 (B:151-263) Cyclin T1 {Human (Homo sapiens) [TaxId: 9606]}
dhphthvvkctqlvraskdlaqtsyfmatnslhlttfslqytppvvacvcihlackwsnw
eipvstdgkhwweyvdatvtlelldeltheflqilektpnrlkriwnwracea

SCOPe Domain Coordinates for d2pk2b1:

Click to download the PDB-style file with coordinates for d2pk2b1.
(The format of our PDB-style files is described here.)

Timeline for d2pk2b1: