SCOPe 2.05: Domain d2pjyb_: 2pjy B:

Lineage for d2pjyb_ (2pjy B:)

1. Root: SCOPe 2.05

2. Class g: Small proteins [56992] (92 folds)

3. Fold g.7: Snake toxin-like [57301] (1 superfamily)
   disulfide-rich fold: nearly all-beta

4. Superfamily g.7.1: Snake toxin-like [57302] (4 families)

5. Family g.7.1.3: Extracellular domain of cell surface receptors [57354] (6 proteins)

6. Protein TGF-beta type II receptor extracellular domain [69951] (2 species)
   elaborated with additional structures resulting in a beta-sandwich fold

7. Species Human (Homo sapiens) [TaxId:9606] [69952] (7 PDB entries)

8. Domain d2pjyb_: 2pjy B: [149584]
   Other proteins in same PDB: d2pjya_
   automated match to d1ploa_

Details for d2pjyb_

PDB Entry: 2pjy, 3 Å

PDB Description: structural basis for cooperative assembly of the tgf-beta signaling complex

PDB Compounds: (B:) TGF-beta receptor type-2

SCOPe Domain Sequences for d2pjyb_:

Sequence; same for both SEQRES and ATOM records:

>d2pjyb_ g.7.1.3 (B:) TGF-beta type II receptor extracellular domain {Human (Homo sapiens) [TaxId: 9606]}
agavkfpqlckfcdvrfstcdnqkscmsncsitsicekpqevcvavwrkndenitletvc
hdpklpyhdfiledaaspkcimkekkkpgetffmcscssdecndniif

Timeline for d2pjyb_:

• d2pjyb_ first appeared in SCOP 1.75, called d2pjyb1
  
• d2pjyb_ appears in SCOPe 2.04
  
• d2pjyb_ appears in SCOPe 2.06
  
• d2pjyb_ appears in the current release, SCOPe 2.08