Lineage for d2pjyb_ (2pjy B:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3032122Fold g.7: Snake toxin-like [57301] (1 superfamily)
    disulfide-rich fold: nearly all-beta
  4. 3032123Superfamily g.7.1: Snake toxin-like [57302] (4 families) (S)
  5. 3032361Family g.7.1.3: Extracellular domain of cell surface receptors [57354] (6 proteins)
  6. 3032401Protein TGF-beta type II receptor extracellular domain [69951] (2 species)
    elaborated with additional structures resulting in a beta-sandwich fold
  7. 3032404Species Human (Homo sapiens) [TaxId:9606] [69952] (9 PDB entries)
  8. 3032414Domain d2pjyb_: 2pjy B: [149584]
    Other proteins in same PDB: d2pjya_
    automated match to d1ploa_

Details for d2pjyb_

PDB Entry: 2pjy (more details), 3 Å

PDB Description: structural basis for cooperative assembly of the tgf-beta signaling complex
PDB Compounds: (B:) TGF-beta receptor type-2

SCOPe Domain Sequences for d2pjyb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pjyb_ g.7.1.3 (B:) TGF-beta type II receptor extracellular domain {Human (Homo sapiens) [TaxId: 9606]}
agavkfpqlckfcdvrfstcdnqkscmsncsitsicekpqevcvavwrkndenitletvc
hdpklpyhdfiledaaspkcimkekkkpgetffmcscssdecndniif

SCOPe Domain Coordinates for d2pjyb_:

Click to download the PDB-style file with coordinates for d2pjyb_.
(The format of our PDB-style files is described here.)

Timeline for d2pjyb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2pjya_