Class g: Small proteins [56992] (98 folds) |
Fold g.17: Cystine-knot cytokines [57500] (1 superfamily) disulfide-rich fold; common core is all-beta |
Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families) |
Family g.17.1.2: Transforming growth factor (TGF)-beta [57507] (8 proteins) |
Protein TGF-beta3 [57508] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [57509] (5 PDB entries) |
Domain d2pjya_: 2pjy A: [149583] Other proteins in same PDB: d2pjyb_ automated match to d1tgja_ |
PDB Entry: 2pjy (more details), 3 Å
SCOPe Domain Sequences for d2pjya_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2pjya_ g.17.1.2 (A:) TGF-beta3 {Human (Homo sapiens) [TaxId: 9606]} aldtnycfrnleenccvrplyidfrqdlgwkwvhepkgyyanfcsgpcpylrsadtthst vlglyntlnpeasaspccvpqdlepltilyyvgrtpkveqlsnmvvksckcs
Timeline for d2pjya_: