SCOPe 2.05: Domain d2pjuc_: 2pju C:

Lineage for d2pjuc_ (2pju C:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.92: Chelatase-like [53799] (3 superfamilies)
   duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.92.3: PrpR receptor domain-like [159800] (1 family)
   recent PDB entry 2q5c belongs to this superfamily
   automatically mapped to Pfam PF06506

5. Family c.92.3.1: PrpR receptor domain-like [159801] (1 protein)
   N-terminal domain corresponds to Pfam PF06506; C-terminal domain, assigned to Pfam PF00158, is distinct from other structures of this Pfam family

6. Protein Propionate catabolism operon regulatory protein PrpR [159802] (1 species)

7. Species Escherichia coli [TaxId:562] [159803] (1 PDB entry)
   Uniprot P77743 11-196

8. Domain d2pjuc_: 2pju C: [149581]
   automated match to d2pjua1

Details for d2pjuc_

PDB Entry: 2pju, 2.1 Å

PDB Description: crystal structure of propionate catabolism operon regulatory protein prpr

PDB Compounds: (C:) Propionate catabolism operon regulatory protein

SCOPe Domain Sequences for d2pjuc_:

Sequence; same for both SEQRES and ATOM records:

>d2pjuc_ c.92.3.1 (C:) Propionate catabolism operon regulatory protein PrpR {Escherichia coli [TaxId: 562]}
kpviwtvsvtrlfelfrdislefdhlanitpiqlgfekavtyirkklanercdaiiaags
ngaylksrlsvpvilikpsgydvlqflakagkltssigvvtyqetipalvafqktfnlrl
dqrsyiteedargqinelkangteavvgaglitdlaeeagmtgifiysaatvrqafsdal
dmtrmslr

Timeline for d2pjuc_:

• d2pjuc_ first appeared in SCOP 1.75, called d2pjuc1
  
• d2pjuc_ appears in SCOPe 2.04
  
• d2pjuc_ appears in SCOPe 2.06
  
• d2pjuc_ appears in the current release, SCOPe 2.08