Lineage for d2pjub_ (2pju B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2912237Fold c.92: Chelatase-like [53799] (3 superfamilies)
    duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134
  4. 2912909Superfamily c.92.3: PrpR receptor domain-like [159800] (1 family) (S)
    recent PDB entry 2q5c belongs to this superfamily
    automatically mapped to Pfam PF06506
  5. 2912910Family c.92.3.1: PrpR receptor domain-like [159801] (1 protein)
    N-terminal domain corresponds to Pfam PF06506; C-terminal domain, assigned to Pfam PF00158, is distinct from other structures of this Pfam family
  6. 2912911Protein Propionate catabolism operon regulatory protein PrpR [159802] (1 species)
  7. 2912912Species Escherichia coli [TaxId:562] [159803] (1 PDB entry)
    Uniprot P77743 11-196
  8. 2912914Domain d2pjub_: 2pju B: [149580]
    Other proteins in same PDB: d2pjud2
    automated match to d2pjua1

Details for d2pjub_

PDB Entry: 2pju (more details), 2.1 Å

PDB Description: crystal structure of propionate catabolism operon regulatory protein prpr
PDB Compounds: (B:) Propionate catabolism operon regulatory protein

SCOPe Domain Sequences for d2pjub_:

Sequence, based on SEQRES records: (download)

>d2pjub_ c.92.3.1 (B:) Propionate catabolism operon regulatory protein PrpR {Escherichia coli [TaxId: 562]}
kpviwtvsvtrlfelfrdislefdhlanitpiqlgfekavtyirkklanercdaiiaags
ngaylksrlsvpvilikpsgydvlqflakagkltssigvvtyqetipalvafqktfnlrl
dqrsyiteedargqinelkangteavvgaglitdlaeeagmtgifiysaatvrqafsdal
dmtrmsl

Sequence, based on observed residues (ATOM records): (download)

>d2pjub_ c.92.3.1 (B:) Propionate catabolism operon regulatory protein PrpR {Escherichia coli [TaxId: 562]}
kpviwtvsvtrlfelfrdislefdhlanitpiqlgfekavtyirkklanercdaiiaags
ngaylksrlsvpvilikpsgydvlqflakagkltssigvvtyqetipalvafqktrldqr
syiteedargqinelkangteavvgaglitdlaeeagmtgifiysaatvrqafsdaldmt
rmsl

SCOPe Domain Coordinates for d2pjub_:

Click to download the PDB-style file with coordinates for d2pjub_.
(The format of our PDB-style files is described here.)

Timeline for d2pjub_: