![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.92: Chelatase-like [53799] (3 superfamilies) duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134 |
![]() | Superfamily c.92.3: PrpR receptor domain-like [159800] (1 family) ![]() recent PDB entry 2q5c belongs to this superfamily automatically mapped to Pfam PF06506 |
![]() | Family c.92.3.1: PrpR receptor domain-like [159801] (1 protein) N-terminal domain corresponds to Pfam PF06506; C-terminal domain, assigned to Pfam PF00158, is distinct from other structures of this Pfam family |
![]() | Protein Propionate catabolism operon regulatory protein PrpR [159802] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [159803] (1 PDB entry) Uniprot P77743 11-196 |
![]() | Domain d2pjub_: 2pju B: [149580] Other proteins in same PDB: d2pjud2 automated match to d2pjua1 |
PDB Entry: 2pju (more details), 2.1 Å
SCOPe Domain Sequences for d2pjub_:
Sequence, based on SEQRES records: (download)
>d2pjub_ c.92.3.1 (B:) Propionate catabolism operon regulatory protein PrpR {Escherichia coli [TaxId: 562]} kpviwtvsvtrlfelfrdislefdhlanitpiqlgfekavtyirkklanercdaiiaags ngaylksrlsvpvilikpsgydvlqflakagkltssigvvtyqetipalvafqktfnlrl dqrsyiteedargqinelkangteavvgaglitdlaeeagmtgifiysaatvrqafsdal dmtrmsl
>d2pjub_ c.92.3.1 (B:) Propionate catabolism operon regulatory protein PrpR {Escherichia coli [TaxId: 562]} kpviwtvsvtrlfelfrdislefdhlanitpiqlgfekavtyirkklanercdaiiaags ngaylksrlsvpvilikpsgydvlqflakagkltssigvvtyqetipalvafqktrldqr syiteedargqinelkangteavvgaglitdlaeeagmtgifiysaatvrqafsdaldmt rmsl
Timeline for d2pjub_:
![]() Domains from other chains: (mouse over for more information) d2pjua1, d2pjuc_, d2pjud1, d2pjud2 |