![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily) beta-alpha-beta(3); 2 layers: alpha/beta |
![]() | Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) ![]() |
![]() | Family d.32.1.2: Antibiotic resistance proteins [54598] (8 proteins) duplication: consists of two clear structural repeats each having this fold subunit fold and dimeric assembly are similar to those of glyoxalase |
![]() | Protein Uncharacterized protein Atu1953 [160145] (1 species) |
![]() | Species Agrobacterium tumefaciens [TaxId:358] [160146] (1 PDB entry) Uniprot Q8UE11 2-115 |
![]() | Domain d2pjsb_: 2pjs B: [149574] automated match to d2pjsa1 complexed with zn |
PDB Entry: 2pjs (more details), 1.85 Å
SCOPe Domain Sequences for d2pjsb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2pjsb_ d.32.1.2 (B:) Uncharacterized protein Atu1953 {Agrobacterium tumefaciens [TaxId: 358]} avrrvvaniatpeparaqafygdilgmpvamdhgwivthaspleahaqvsfareggsgtd vpdlsievdnfdevharilkaglpieygpvteawgvqrlflrdpfgklinils
Timeline for d2pjsb_: