Lineage for d2pjsb_ (2pjs B:)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
beta-alpha-beta(3); 2 layers: alpha/betaSuperfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) 
Family d.32.1.2: Antibiotic resistance proteins [54598] (8 proteins)
duplication: consists of two clear structural repeats each having this fold
subunit fold and dimeric assembly are similar to those of glyoxalase
Protein Uncharacterized protein Atu1953 [160145] (1 species) Species Agrobacterium tumefaciens [TaxId:358] [160146] (1 PDB entry)
Uniprot Q8UE11 2-115
Domain d2pjsb_: 2pjs B: [149574]
automated match to d2pjsa1
complexed with zn
Details for d2pjsb_
PDB Entry: 2pjs (more details), 1.85 Å
PDB Description: Crystal structure of Atu1953, protein of unknown function
PDB Compounds: (B:) Uncharacterized protein Atu1953SCOPe Domain Sequences for d2pjsb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2pjsb_ d.32.1.2 (B:) Uncharacterized protein Atu1953 {Agrobacterium tumefaciens [TaxId: 358]}
avrrvvaniatpeparaqafygdilgmpvamdhgwivthaspleahaqvsfareggsgtd
vpdlsievdnfdevharilkaglpieygpvteawgvqrlflrdpfgklinils
SCOPe Domain Coordinates for d2pjsb_:
Click to download the PDB-style file with coordinates for d2pjsb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2pjsb_:
- d2pjsb_ first appeared in SCOP 1.75, called d2pjsb1
- d2pjsb_ appears in SCOPe 2.07
View in 3D
