Lineage for d2pjsa1 (2pjs A:3-113)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 858111Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
    beta-alpha-beta(3); 2 layers: alpha/beta
  4. 858112Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (10 families) (S)
  5. 858148Family d.32.1.2: Antibiotic resistance proteins [54598] (7 proteins)
    duplication: consists of two clear structural repeats each having this fold
    subunit fold and dimeric assembly are similar to those of glyoxalase
  6. 858214Protein Uncharacterized protein Atu1953 [160145] (1 species)
  7. 858215Species Agrobacterium tumefaciens [TaxId:358] [160146] (1 PDB entry)
    Uniprot Q8UE11 2-115
  8. 858216Domain d2pjsa1: 2pjs A:3-113 [149573]
    segment-swapped dimer with an unusual middle-strand swap
    complexed with zn

Details for d2pjsa1

PDB Entry: 2pjs (more details), 1.85 Å

PDB Description: Crystal structure of Atu1953, protein of unknown function
PDB Compounds: (A:) Uncharacterized protein Atu1953

SCOP Domain Sequences for d2pjsa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pjsa1 d.32.1.2 (A:3-113) Uncharacterized protein Atu1953 {Agrobacterium tumefaciens [TaxId: 358]}
vrrvvaniatpeparaqafygdilgmpvamdhgwivthaspleahaqvsfareggsgtdv
pdlsievdnfdevharilkaglpieygpvteawgvqrlflrdpfgklinil

SCOP Domain Coordinates for d2pjsa1:

Click to download the PDB-style file with coordinates for d2pjsa1.
(The format of our PDB-style files is described here.)

Timeline for d2pjsa1: