Lineage for d2pjqd_ (2pjq D:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2014835Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
    multihelical; consists of two different alpha-helical bundles
  4. 2014836Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families) (S)
  5. 2014837Family a.211.1.1: HD domain [101340] (14 protein domains)
    Pfam PF01966; metal dependent phosphohydrolases
  6. 2014903Protein Uncharacterized protein LP2664 [158729] (1 species)
  7. 2014904Species Lactobacillus plantarum [TaxId:1590] [158730] (1 PDB entry)
    Uniprot Q88U62 1-215
  8. 2014908Domain d2pjqd_: 2pjq D: [149572]
    automated match to d2pjqa1

Details for d2pjqd_

PDB Entry: 2pjq (more details), 2.8 Å

PDB Description: crystal structure of q88u62_lacpl from lactobacillus plantarum. northeast structural genomics target lpr71
PDB Compounds: (D:) Uncharacterized protein lp_2664

SCOPe Domain Sequences for d2pjqd_:

Sequence, based on SEQRES records: (download)

>d2pjqd_ a.211.1.1 (D:) Uncharacterized protein LP2664 {Lactobacillus plantarum [TaxId: 1590]}
mitetqltaiqtyalqklahdhsghgrdhlqrvnrlarrlakdeganlnltlaaawlhdv
iddklmanpakahqdlivqlnaqnvtaddqtaifaiidhmsfsksfngpqklslegqvvq
dadrldaigaigiaralyysghvgekiydpaiaprehmtreqyrhqpgtainhfyeklfk
laalmntdtakalaahrtavmhefvdqfkaewtad

Sequence, based on observed residues (ATOM records): (download)

>d2pjqd_ a.211.1.1 (D:) Uncharacterized protein LP2664 {Lactobacillus plantarum [TaxId: 1590]}
mitetqltaiqtyalqklahdhsghgrdhlqrvnrlarrlakdeganlnltlaaawlhdv
idahqdlivqlnaqnvtqtaifaiidhmsfsksfngpqklslegqvvqdadrldaigaig
iaralyysghvgekiydpaiaprehmtreqyrhqpgtainhfyeklfklaalmntdtaka
laahrtavmhefvdqfkaewtad

SCOPe Domain Coordinates for d2pjqd_:

Click to download the PDB-style file with coordinates for d2pjqd_.
(The format of our PDB-style files is described here.)

Timeline for d2pjqd_: