![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily) multihelical; consists of two different alpha-helical bundles |
![]() | Superfamily a.211.1: HD-domain/PDEase-like [109604] (9 families) ![]() |
![]() | Family a.211.1.1: HD domain [101340] (15 proteins) Pfam PF01966; metal dependent phosphohydrolases |
![]() | Protein Uncharacterized protein LP2664 [158729] (1 species) |
![]() | Species Lactobacillus plantarum [TaxId:1590] [158730] (1 PDB entry) Uniprot Q88U62 1-215 |
![]() | Domain d2pjqd_: 2pjq D: [149572] automated match to d2pjqa1 |
PDB Entry: 2pjq (more details), 2.8 Å
SCOPe Domain Sequences for d2pjqd_:
Sequence, based on SEQRES records: (download)
>d2pjqd_ a.211.1.1 (D:) Uncharacterized protein LP2664 {Lactobacillus plantarum [TaxId: 1590]} mitetqltaiqtyalqklahdhsghgrdhlqrvnrlarrlakdeganlnltlaaawlhdv iddklmanpakahqdlivqlnaqnvtaddqtaifaiidhmsfsksfngpqklslegqvvq dadrldaigaigiaralyysghvgekiydpaiaprehmtreqyrhqpgtainhfyeklfk laalmntdtakalaahrtavmhefvdqfkaewtad
>d2pjqd_ a.211.1.1 (D:) Uncharacterized protein LP2664 {Lactobacillus plantarum [TaxId: 1590]} mitetqltaiqtyalqklahdhsghgrdhlqrvnrlarrlakdeganlnltlaaawlhdv idahqdlivqlnaqnvtqtaifaiidhmsfsksfngpqklslegqvvqdadrldaigaig iaralyysghvgekiydpaiaprehmtreqyrhqpgtainhfyeklfklaalmntdtaka laahrtavmhefvdqfkaewtad
Timeline for d2pjqd_: