Lineage for d2pjhb1 (2pjh B:21-106)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 804836Fold b.52: Double psi beta-barrel [50684] (2 superfamilies)
    barrel, closed; n=6, S=10; complex topology with crossover (psi) loops
  4. 804878Superfamily b.52.2: ADC-like [50692] (3 families) (S)
  5. 805019Family b.52.2.3: Cdc48 N-terminal domain-like [50708] (4 proteins)
  6. 805020Protein Membrane fusion ATPase p97 N-terminal domain , P97-Nn [63796] (1 species)
  7. 805021Species Mouse (Mus musculus) [TaxId:10090] [63797] (5 PDB entries)
  8. 805023Domain d2pjhb1: 2pjh B:21-106 [149563]
    Other proteins in same PDB: d2pjhb2
    automatically matched to d1r7ra1

Details for d2pjhb1

PDB Entry: 2pjh (more details)

PDB Description: strctural model of the p97 n domain- npl4 ubd complex
PDB Compounds: (B:) Transitional endoplasmic reticulum ATPase

SCOP Domain Sequences for d2pjhb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pjhb1 b.52.2.3 (B:21-106) Membrane fusion ATPase p97 N-terminal domain , P97-Nn {Mouse (Mus musculus) [TaxId: 10090]}
nrpnrlivdeainednsvvslsqpkmdelqlfrgdtvllkgkkrreavcivlsddtcsde
kirmnrvvrnnlrvrlgdvisiqpcp

SCOP Domain Coordinates for d2pjhb1:

Click to download the PDB-style file with coordinates for d2pjhb1.
(The format of our PDB-style files is described here.)

Timeline for d2pjhb1: