SCOP 1.75: Domain d2pj7b1: 2pj7 B:6-308

Lineage for d2pj7b1 (2pj7 B:6-308)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
   core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops

4. Superfamily c.56.5: Zn-dependent exopeptidases [53187] (9 families)
   core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest

5. Family c.56.5.1: Pancreatic carboxypeptidases [53188] (4 proteins)

6. Protein Carboxypeptidase B [53193] (4 species)

7. Species Pig (Sus scrofa) [TaxId:9823] [53194] (21 PDB entries)

8. Domain d2pj7b1: 2pj7 B:6-308 [149547]
   automatically matched to d1z5ra1
   complexed with 235, zn

Details for d2pj7b1

PDB Entry: 2pj7, 1.77 Å

PDB Description: crystal structure of activated porcine pancreatic carboxypeptidase b 2-(3-aminomethyl-phenyl)-3-[((r)-1-benzenesulfonylamino-2-methyl-propyl)-hydroxy-phosphinoyl]-propionic acid complex

PDB Compounds: (B:) carboxypeptidase b

SCOP Domain Sequences for d2pj7b1:

Sequence; same for both SEQRES and ATOM records:

>d2pj7b1 c.56.5.1 (B:6-308) Carboxypeptidase B {Pig (Sus scrofa) [TaxId: 9823]}
ghsyekynnwetieawtkqvtsenpdlisrtaigttflgnniyllkvgkpgpnkpaifmd
cgfharewishafcqwfvreavltygyeshmteflnkldfyvlpvlnidgyiytwtknrm
wrktrstnagttcigtdpnrnfdagwcttgastdpcdetycgsaaeseketkaladfirn
nlssikayltihsysqmilypysydyklpennaelnnlakaavkelatlygtkytygpga
ttiypaaggsddwaydqgikysftfelrdkgrygfilpesqiqatceetmlaikyvtnyv
lghl

Timeline for d2pj7b1:

• d2pj7b1 is new in SCOP 1.75
  
• d2pj7b1 is called d2pj7b_ in SCOPe 2.01
  
• d2pj7b1 appears in the current release, SCOPe 2.08, called d2pj7b_