SCOPe 2.07: Domain d2pj5a_: 2pj5 A:

Lineage for d2pj5a_ (2pj5 A:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
   core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops

4. Superfamily c.56.5: Zn-dependent exopeptidases [53187] (10 families)
   core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest

5. Family c.56.5.1: Pancreatic carboxypeptidases [53188] (5 proteins)

6. Protein automated matches [190397] (2 species)
   not a true protein

7. Species Pig (Sus scrofa) [TaxId:9823] [187266] (20 PDB entries)

8. Domain d2pj5a_: 2pj5 A: [149542]
   automated match to d1z5ra1
   complexed with 11b, zn

Details for d2pj5a_

PDB Entry: 2pj5, 1.65 Å

PDB Description: crystal structure of activated porcine pancreatic carboxypeptidase b [((r)-1-benzyloxycarbonylamino-hexyl)-hydroxy-phosphinoyloxy]-(3-guanidino-phenyl)-acetic acid complex

PDB Compounds: (A:) carboxypeptidase b

SCOPe Domain Sequences for d2pj5a_:

Sequence; same for both SEQRES and ATOM records:

>d2pj5a_ c.56.5.1 (A:) automated matches {Pig (Sus scrofa) [TaxId: 9823]}
ghsyekynnwetieawtkqvtsenpdlisrtaigttflgnniyllkvgkpgpnkpaifmd
cgfharewishafcqwfvreavltygyeshmteflnkldfyvlpvlnidgyiytwtknrm
wrktrstnagttcigtdpnrnfdagwcttgastdpcdetycgsaaeseketkaladfirn
nlssikayltihsysqmilypysydyklpennaelnnlakaavkelatlygtkytygpga
ttiypaaggsddwaydqgikysftfelrdkgrygfilpesqiqatceetmlaikyvtnyv
lghl

Timeline for d2pj5a_:

• d2pj5a_ first appeared in SCOP 1.75, called d2pj5a1
  
• d2pj5a_ appears in SCOPe 2.06
  
• d2pj5a_ appears in the current release, SCOPe 2.08