Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies) core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops |
Superfamily c.56.5: Zn-dependent exopeptidases [53187] (9 families) core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest |
Family c.56.5.1: Pancreatic carboxypeptidases [53188] (4 proteins) |
Protein Carboxypeptidase B [53193] (4 species) |
Species Pig (Sus scrofa) [TaxId:9823] [53194] (21 PDB entries) |
Domain d2pj3b1: 2pj3 B:6-308 [149538] automatically matched to d1z5ra1 complexed with 86a, zn |
PDB Entry: 2pj3 (more details), 1.64 Å
SCOP Domain Sequences for d2pj3b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2pj3b1 c.56.5.1 (B:6-308) Carboxypeptidase B {Pig (Sus scrofa) [TaxId: 9823]} ghsyekynnwetieawtkqvtsenpdlisrtaigttflgnniyllkvgkpgpnkpaifmd cgfharewishafcqwfvreavltygyeshmteflnkldfyvlpvlnidgyiytwtknrm wrktrstnagttcigtdpnrnfdagwcttgastdpcdetycgsaaeseketkaladfirn nlssikayltihsysqmilypysydyklpennaelnnlakaavkelatlygtkytygpga ttiypaaggsddwaydqgikysftfelrdkgrygfilpesqiqatceetmlaikyvtnyv lghl
Timeline for d2pj3b1: