Lineage for d2pj3b1 (2pj3 B:6-308)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 837609Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 838036Superfamily c.56.5: Zn-dependent exopeptidases [53187] (9 families) (S)
    core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest
  5. 838037Family c.56.5.1: Pancreatic carboxypeptidases [53188] (4 proteins)
  6. 838091Protein Carboxypeptidase B [53193] (4 species)
  7. 838101Species Pig (Sus scrofa) [TaxId:9823] [53194] (21 PDB entries)
  8. 838116Domain d2pj3b1: 2pj3 B:6-308 [149538]
    automatically matched to d1z5ra1
    complexed with 86a, zn

Details for d2pj3b1

PDB Entry: 2pj3 (more details), 1.64 Å

PDB Description: crystal structure of activated porcine pancreatic carboxypeptidase b (3-guanidino-phenyl)-{hydroxy-[(r)-2-methyl-1-(3-phenyl-propionylamino)-propyl]-phosphinoyloxy}-acetic acid complex
PDB Compounds: (B:) carboxypeptidase b

SCOP Domain Sequences for d2pj3b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pj3b1 c.56.5.1 (B:6-308) Carboxypeptidase B {Pig (Sus scrofa) [TaxId: 9823]}
ghsyekynnwetieawtkqvtsenpdlisrtaigttflgnniyllkvgkpgpnkpaifmd
cgfharewishafcqwfvreavltygyeshmteflnkldfyvlpvlnidgyiytwtknrm
wrktrstnagttcigtdpnrnfdagwcttgastdpcdetycgsaaeseketkaladfirn
nlssikayltihsysqmilypysydyklpennaelnnlakaavkelatlygtkytygpga
ttiypaaggsddwaydqgikysftfelrdkgrygfilpesqiqatceetmlaikyvtnyv
lghl

SCOP Domain Coordinates for d2pj3b1:

Click to download the PDB-style file with coordinates for d2pj3b1.
(The format of our PDB-style files is described here.)

Timeline for d2pj3b1: