![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies) core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops |
![]() | Superfamily c.56.5: Zn-dependent exopeptidases [53187] (10 families) ![]() core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest |
![]() | Family c.56.5.1: Pancreatic carboxypeptidases [53188] (5 proteins) |
![]() | Protein automated matches [190397] (2 species) not a true protein |
![]() | Species Pig (Sus scrofa) [TaxId:9823] [187266] (20 PDB entries) |
![]() | Domain d2pj1c_: 2pj1 C: [149533] automated match to d1z5ra1 complexed with 578, zn |
PDB Entry: 2pj1 (more details), 1.64 Å
SCOPe Domain Sequences for d2pj1c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2pj1c_ c.56.5.1 (C:) automated matches {Pig (Sus scrofa) [TaxId: 9823]} tghsyekynnwetieawtkqvtsenpdlisrtaigttflgnniyllkvgkpgpnkpaifm dcgfharewishafcqwfvreavltygyeshmteflnkldfyvlpvlnidgyiytwtknr mwrktrstnagttcigtdpnrnfdagwcttgastdpcdetycgsaaeseketkaladfir nnlssikayltihsysqmilypysydyklpennaelnnlakaavkelatlygtkytygpg attiypaaggsddwaydqgikysftfelrdkgrygfilpesqiqatceetmlaikyvtny vlghl
Timeline for d2pj1c_: