Lineage for d2pita1 (2pit A:670-918)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 776482Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 776483Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (1 family) (S)
  5. 776484Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (33 protein domains)
  6. 776485Protein Androgen receptor [63621] (3 species)
  7. 776495Species Human (Homo sapiens) [TaxId:9606] [63623] (36 PDB entries)
    Uniprot P10275 671-919
  8. 776508Domain d2pita1: 2pit A:670-918 [149517]
    automatically matched to d1e3ga_
    complexed with 4hy, dht, so4

Details for d2pita1

PDB Entry: 2pit (more details), 1.76 Å

PDB Description: androgen receptor lbd with small molecule
PDB Compounds: (A:) Androgen receptor

SCOP Domain Sequences for d2pita1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pita1 a.123.1.1 (A:670-918) Androgen receptor {Human (Homo sapiens) [TaxId: 9606]}
qpiflnvleaiepgvvcaghdnnqpdsfaallsslnelgerqlvhvvkwakalpgfrnlh
vddqmaviqyswmglmvfamgwrsftnvnsrmlyfapdlvfneyrmhksrmysqcvrmrh
lsqefgwlqitpqeflcmkalllfsiipvdglknqkffdelrmnyikeldriiackrknp
tscsrrfyqltklldsvqpiarelhqftfdllikshmvsvdfpemmaeiisvqvpkilsg
kvkpiyfht

SCOP Domain Coordinates for d2pita1:

Click to download the PDB-style file with coordinates for d2pita1.
(The format of our PDB-style files is described here.)

Timeline for d2pita1: