Lineage for d2pioa_ (2pio A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2728284Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2728285Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2728286Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. 2728287Protein Androgen receptor [63621] (4 species)
  7. 2728297Species Human (Homo sapiens) [TaxId:9606] [63623] (65 PDB entries)
    Uniprot P10275 671-919
  8. 2728342Domain d2pioa_: 2pio A: [149513]
    automated match to d1e3ga_
    complexed with 2mi, dht, so4

Details for d2pioa_

PDB Entry: 2pio (more details), 2.03 Å

PDB Description: androgen receptor lbd with small molecule
PDB Compounds: (A:) Androgen receptor

SCOPe Domain Sequences for d2pioa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pioa_ a.123.1.1 (A:) Androgen receptor {Human (Homo sapiens) [TaxId: 9606]}
piflnvleaiepgvvcaghdnnqpdsfaallsslnelgerqlvhvvkwakalpgfrnlhv
ddqmaviqyswmglmvfamgwrsftnvnsrmlyfapdlvfneyrmhksrmysqcvrmrhl
sqefgwlqitpqeflcmkalllfsiipvdglknqkffdelrmnyikeldriiackrknpt
scsrrfyqltklldsvqpiarelhqftfdllikshmvsvdfpemmaeiisvqvpkilsgk
vkpiyfht

SCOPe Domain Coordinates for d2pioa_:

Click to download the PDB-style file with coordinates for d2pioa_.
(The format of our PDB-style files is described here.)

Timeline for d2pioa_: