SCOPe 2.07: Domain d2piea2: 2pie A:13-140

Lineage for d2piea2 (2pie A:13-140)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.26: SMAD/FHA domain [49878] (1 superfamily)
   sandwich; 11 strands in 2 sheets; greek-key

4. Superfamily b.26.1: SMAD/FHA domain [49879] (5 families)
   has a few short helices inserted in loops

5. Family b.26.1.2: FHA domain [49885] (12 proteins)

6. Protein automated matches [190379] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187226] (2 PDB entries)

8. Domain d2piea2: 2pie A:13-140 [149508]
   Other proteins in same PDB: d2piea3
   automated match to d2cswa1

Details for d2piea2

PDB Entry: 2pie, 1.35 Å

PDB Description: crystal structure of the fha domain of rnf8 in complex with its optimal phosphopeptide

PDB Compounds: (A:) E3 ubiquitin-protein ligase RNF8

SCOPe Domain Sequences for d2piea2:

Sequence; same for both SEQRES and ATOM records:

>d2piea2 b.26.1.2 (A:13-140) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aggrswclrrvgmsagwllledgcevtvgrgfgvtyqlvskicplmisrnhcvlkqnpeg
qwtimdnkslngvwlnrarleplrvysihqgdyiqlgvplenkenaeyeyevteedweti
ypclspkn

Timeline for d2piea2:

• d2piea2 first appeared in SCOP 1.75, called d2piea1
  
• d2piea2 appears in SCOPe 2.06
  
• d2piea2 appears in the current release, SCOPe 2.08