Class b: All beta proteins [48724] (178 folds) |
Fold b.26: SMAD/FHA domain [49878] (1 superfamily) sandwich; 11 strands in 2 sheets; greek-key |
Superfamily b.26.1: SMAD/FHA domain [49879] (5 families) has a few short helices inserted in loops |
Family b.26.1.2: FHA domain [49885] (12 proteins) |
Protein automated matches [190379] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187226] (2 PDB entries) |
Domain d2piea2: 2pie A:13-140 [149508] Other proteins in same PDB: d2piea3 automated match to d2cswa1 |
PDB Entry: 2pie (more details), 1.35 Å
SCOPe Domain Sequences for d2piea2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2piea2 b.26.1.2 (A:13-140) automated matches {Human (Homo sapiens) [TaxId: 9606]} aggrswclrrvgmsagwllledgcevtvgrgfgvtyqlvskicplmisrnhcvlkqnpeg qwtimdnkslngvwlnrarleplrvysihqgdyiqlgvplenkenaeyeyevteedweti ypclspkn
Timeline for d2piea2: