Lineage for d2piea2 (2pie A:13-140)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2372848Fold b.26: SMAD/FHA domain [49878] (1 superfamily)
    sandwich; 11 strands in 2 sheets; greek-key
  4. 2372849Superfamily b.26.1: SMAD/FHA domain [49879] (5 families) (S)
    has a few short helices inserted in loops
  5. 2372888Family b.26.1.2: FHA domain [49885] (12 proteins)
  6. 2372954Protein automated matches [190379] (1 species)
    not a true protein
  7. 2372955Species Human (Homo sapiens) [TaxId:9606] [187226] (2 PDB entries)
  8. 2372956Domain d2piea2: 2pie A:13-140 [149508]
    Other proteins in same PDB: d2piea3
    automated match to d2cswa1

Details for d2piea2

PDB Entry: 2pie (more details), 1.35 Å

PDB Description: crystal structure of the fha domain of rnf8 in complex with its optimal phosphopeptide
PDB Compounds: (A:) E3 ubiquitin-protein ligase RNF8

SCOPe Domain Sequences for d2piea2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2piea2 b.26.1.2 (A:13-140) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aggrswclrrvgmsagwllledgcevtvgrgfgvtyqlvskicplmisrnhcvlkqnpeg
qwtimdnkslngvwlnrarleplrvysihqgdyiqlgvplenkenaeyeyevteedweti
ypclspkn

SCOPe Domain Coordinates for d2piea2:

Click to download the PDB-style file with coordinates for d2piea2.
(The format of our PDB-style files is described here.)

Timeline for d2piea2: