Lineage for d2pi8b_ (2pi8 B:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2412093Fold b.52: Double psi beta-barrel [50684] (2 superfamilies)
    barrel, closed; n=6, S=10; complex topology with crossover (psi) loops
  4. 2412094Superfamily b.52.1: Barwin-like endoglucanases [50685] (5 families) (S)
  5. 2412132Family b.52.1.4: MLTA-like [159195] (1 protein)
    Pfam PF03562 and Pfam PF06725 cover the middle and C-terminal parts, respectively; contains large insert domain of the L25-like fold (50714)
  6. 2412133Protein Membrane-bound lytic murein transglycosylase A, MLTA [159196] (3 species)
  7. 2412136Species Escherichia coli [TaxId:562] [159198] (5 PDB entries)
    Uniprot P0A935 22-357! Uniprot P0A935 23-357! Uniprot P0A935 24-356
  8. 2412139Domain d2pi8b_: 2pi8 B: [149504]
    automated match to d2ae0x1
    complexed with nag, po4

Details for d2pi8b_

PDB Entry: 2pi8 (more details), 2.25 Å

PDB Description: crystal structure of e. coli mlta with bound chitohexaose
PDB Compounds: (B:) Membrane-bound lytic murein transglycosylase A

SCOPe Domain Sequences for d2pi8b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pi8b_ b.52.1.4 (B:) Membrane-bound lytic murein transglycosylase A, MLTA {Escherichia coli [TaxId: 562]}
skptdrgqqykdgkftqpfslvnqpdavgapinagdfaeqinhirnssprlygnqsnvyn
avqewlraggdtrnmrqfgidawqmegadnygnvqftgyytpviqarhtrqgefqypiyr
mppkrgrlssraeiyagalsdkyilaysnslmdnfimdvqgsgyidfgdgsplnffsyag
knghayrsigkvlidrgevkkedmsmqairhwgethseaevrelleqnpsfvffkpqsfa
pvkgasavplvgrasvasdrsiippgttliaevplldnngkfngqyelrlmvaldvggai
kgqhfaiyqgigpeaghragwynhygrvwvlktap

SCOPe Domain Coordinates for d2pi8b_:

Click to download the PDB-style file with coordinates for d2pi8b_.
(The format of our PDB-style files is described here.)

Timeline for d2pi8b_: