SCOP 1.75: Domain d2pi8b1: 2pi8 B:3-237

Lineage for d2pi8b1 (2pi8 B:3-237)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.52: Double psi beta-barrel [50684] (2 superfamilies)
   barrel, closed; n=6, S=10; complex topology with crossover (psi) loops

4. Superfamily b.52.1: Barwin-like endoglucanases [50685] (4 families)

5. Family b.52.1.4: MLTA-like [159195] (1 protein)
   Pfam PF03562 and Pfam PF06725 cover the middle and C-terminal parts, respectively; contains large insert domain of the L25-like fold ((50714))

6. Protein Membrane-bound lytic murein transglycosylase A, MLTA [159196] (3 species)

7. Species Escherichia coli [TaxId:562] [159198] (5 PDB entries)
   Uniprot P0A935 22-357! Uniprot P0A935 23-357! Uniprot P0A935 24-356

8. Domain d2pi8b1: 2pi8 B:3-237 [149504]
   automatically matched to 2PI8 A:3-237
   complexed with nag, po4; mutant

Details for d2pi8b1

PDB Entry: 2pi8, 2.25 Å

PDB Description: crystal structure of e. coli mlta with bound chitohexaose

PDB Compounds: (B:) Membrane-bound lytic murein transglycosylase A

SCOP Domain Sequences for d2pi8b1:

Sequence; same for both SEQRES and ATOM records:

>d2pi8b1 b.52.1.4 (B:3-237) Membrane-bound lytic murein transglycosylase A, MLTA {Escherichia coli [TaxId: 562]}
skptdrgqqykdgkftqpfslvnqpdavgapinagdfaeqinhirnssprlygnqsnvyn
avqewlraggdtrnmrqfgidawqmegadnygnvqftgyytpviqarhtrqgefqypiyr
mppkrgrlssraeiyagalsdkyilaysnslmdnfimdvqgsgyidfgdgsplnffsyag
knghayrsigkvlidrgevkkedmsmqairhwgethseaevrelleqnpsfvffk

Timeline for d2pi8b1:

• d2pi8b1 is new in SCOP 1.75
  
• d2pi8b1 is called d2pi8b_ in SCOPe 2.01
  
• d2pi8b1 appears in the current release, SCOPe 2.08, called d2pi8b_