SCOPe 2.05: Domain d2pi6a2: 2pi6 A:240-307

Lineage for d2pi6a2 (2pi6 A:240-307)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.26: FKBP-like [54533] (3 superfamilies)
   core: beta(2)-alpha-beta(2); antiparallel beta-sheet

4. Superfamily d.26.3: Chitinase insertion domain [54556] (1 family)

5. Family d.26.3.1: Chitinase insertion domain [54557] (10 proteins)

6. Protein Signal processing protein (SPC-40, MGP-40) [89882] (5 species)
   secreted during involution

7. Species Sheep (Ovis aries) [TaxId:9940] [109621] (11 PDB entries)
   Uniprot Q6TMG6

8. Domain d2pi6a2: 2pi6 A:240-307 [149502]
   Other proteins in same PDB: d2pi6a1
   automatically matched to d1ljya2
   complexed with eoh, mpd

Details for d2pi6a2

PDB Entry: 2pi6, 1.65 Å

PDB Description: crystal structure of the sheep signalling glycoprotein (sps-40) complex with 2-methyl-2-4-pentanediol at 1.65a resolution reveals specific binding characteristics of sps-40

PDB Compounds: (A:) Chitinase-3-like protein 1

SCOPe Domain Sequences for d2pi6a2:

Sequence; same for both SEQRES and ATOM records:

>d2pi6a2 d.26.3.1 (A:240-307) Signal processing protein (SPC-40, MGP-40) {Sheep (Ovis aries) [TaxId: 9940]}
fgrsftlassktdvgapvsgpgipgrftkekgilayyeicdflhgatthrfrdqqvpyat
kgnqwvay

Timeline for d2pi6a2:

• d2pi6a2 first appeared in SCOP 1.75
  
• d2pi6a2 appears in SCOPe 2.04
  
• d2pi6a2 appears in SCOPe 2.06
  
• d2pi6a2 appears in the current release, SCOPe 2.08