Lineage for d2pi6a1 (2pi6 A:1-239,A:308-361)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1565956Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1568602Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 1570170Family c.1.8.5: Type II chitinase [51534] (15 proteins)
    glycosylase family 18
  6. 1570348Protein Signal processing protein (SPC-40, MGP-40) [89480] (5 species)
    secreted during involution
  7. 1570380Species Sheep (Ovis aries) [TaxId:9940] [109611] (11 PDB entries)
    Uniprot Q6TMG6
  8. 1570381Domain d2pi6a1: 2pi6 A:1-239,A:308-361 [149501]
    Other proteins in same PDB: d2pi6a2
    automatically matched to d1ljya1
    complexed with eoh, mpd

Details for d2pi6a1

PDB Entry: 2pi6 (more details), 1.65 Å

PDB Description: crystal structure of the sheep signalling glycoprotein (sps-40) complex with 2-methyl-2-4-pentanediol at 1.65a resolution reveals specific binding characteristics of sps-40
PDB Compounds: (A:) Chitinase-3-like protein 1

SCOPe Domain Sequences for d2pi6a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pi6a1 c.1.8.5 (A:1-239,A:308-361) Signal processing protein (SPC-40, MGP-40) {Sheep (Ovis aries) [TaxId: 9940]}
yklicyytswsqyregdgscfpdaidpflcthviytfanisnneidtwewndvtlydtln
tlknrnpklktllsvggwnfgperfskiasktqsrrtfiksvppflrthgfdgldlawly
pgrrdkrhlttlvkemkaefireaqagteqlllsaavsagkiaidrgydiaqisrhldfi
slltydfhgawrqtvghhsplfrgnedassrfsnadyavsymlrlgapanklvmgiptXd
dqesvknkarylknrqlagamvwaldlddfrgtfcgqnltfpltsavkdvlae

SCOPe Domain Coordinates for d2pi6a1:

Click to download the PDB-style file with coordinates for d2pi6a1.
(The format of our PDB-style files is described here.)

Timeline for d2pi6a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2pi6a2