Class b: All beta proteins [48724] (178 folds) |
Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) |
Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (13 proteins) barrel, closed; n=5, S=10 |
Protein automated matches [190206] (10 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [186959] (27 PDB entries) |
Domain d2pi2e_: 2pi2 E: [149497] Other proteins in same PDB: d2pi2a_, d2pi2b_, d2pi2c_, d2pi2d_ automated match to d3kdfc_ complexed with dio |
PDB Entry: 2pi2 (more details), 2 Å
SCOPe Domain Sequences for d2pi2e_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2pi2e_ b.40.4.3 (E:) automated matches {Human (Homo sapiens) [TaxId: 9606]} vdmmdlprsrinagmlaqfidkpvcfvgrlekihptgkmfilsdgegkngtielmeplde eisgivevvgrvtakatilctsyvqfkedshpfdlglyneavkiihdfpqfyplgiv
Timeline for d2pi2e_: