Lineage for d2pi2e_ (2pi2 E:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2397497Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2398897Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) (S)
  5. 2398969Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (13 proteins)
    barrel, closed; n=5, S=10
  6. 2399161Protein automated matches [190206] (10 species)
    not a true protein
  7. 2399174Species Human (Homo sapiens) [TaxId:9606] [186959] (27 PDB entries)
  8. 2399196Domain d2pi2e_: 2pi2 E: [149497]
    Other proteins in same PDB: d2pi2a_, d2pi2b_, d2pi2c_, d2pi2d_
    automated match to d3kdfc_
    complexed with dio

Details for d2pi2e_

PDB Entry: 2pi2 (more details), 2 Å

PDB Description: Full-length Replication protein A subunits RPA14 and RPA32
PDB Compounds: (E:) Replication protein A 14 kDa subunit

SCOPe Domain Sequences for d2pi2e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pi2e_ b.40.4.3 (E:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vdmmdlprsrinagmlaqfidkpvcfvgrlekihptgkmfilsdgegkngtielmeplde
eisgivevvgrvtakatilctsyvqfkedshpfdlglyneavkiihdfpqfyplgiv

SCOPe Domain Coordinates for d2pi2e_:

Click to download the PDB-style file with coordinates for d2pi2e_.
(The format of our PDB-style files is described here.)

Timeline for d2pi2e_: