Lineage for d2pi2d_ (2pi2 D:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2058098Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2059387Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) (S)
  5. 2059459Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (13 proteins)
    barrel, closed; n=5, S=10
  6. 2059527Protein Replication protein A 32 KDa subunit (RPA32) fragment [50269] (1 species)
  7. 2059528Species Human (Homo sapiens) [TaxId:9606] [50270] (5 PDB entries)
  8. 2059532Domain d2pi2d_: 2pi2 D: [149496]
    Other proteins in same PDB: d2pi2e_, d2pi2f_, d2pi2g_, d2pi2h_
    automated match to d2pqaa_
    complexed with dio

Details for d2pi2d_

PDB Entry: 2pi2 (more details), 2 Å

PDB Description: Full-length Replication protein A subunits RPA14 and RPA32
PDB Compounds: (D:) Replication protein A 32 kDa subunit

SCOPe Domain Sequences for d2pi2d_:

Sequence, based on SEQRES records: (download)

>d2pi2d_ b.40.4.3 (D:) Replication protein A 32 KDa subunit (RPA32) fragment {Human (Homo sapiens) [TaxId: 9606]}
aqhivpctisqllsatlvdevfrignveisqvtivgiirhaekaptnivykiddmtaapm
dvrqwvdtddtssentvvppetyvkvaghlrsfqnkkslvafkimpledmneftthilev
inahmvlskans

Sequence, based on observed residues (ATOM records): (download)

>d2pi2d_ b.40.4.3 (D:) Replication protein A 32 KDa subunit (RPA32) fragment {Human (Homo sapiens) [TaxId: 9606]}
aqhivpctisqllsatlvdevfrignveisqvtivgiirhaekaptnivykiddmtaapm
dvrqwvtvvppetyvkvaghlrsfqnkkslvafkimpledmneftthilevinahmvlsk
ans

SCOPe Domain Coordinates for d2pi2d_:

Click to download the PDB-style file with coordinates for d2pi2d_.
(The format of our PDB-style files is described here.)

Timeline for d2pi2d_: