Lineage for d2pi2b1 (2pi2 B:44-171)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 798661Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 799407Superfamily b.40.4: Nucleic acid-binding proteins [50249] (16 families) (S)
  5. 799474Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (12 proteins)
    barrel, closed; n=5, S=10
  6. 799552Protein Replication protein A 32 KDa subunit (RPA32) fragment [50269] (1 species)
  7. 799553Species Human (Homo sapiens) [TaxId:9606] [50270] (5 PDB entries)
  8. 799555Domain d2pi2b1: 2pi2 B:44-171 [149494]
    Other proteins in same PDB: d2pi2e1, d2pi2f1, d2pi2g1, d2pi2h1
    automatically matched to d1l1ob_
    complexed with dio

Details for d2pi2b1

PDB Entry: 2pi2 (more details), 2 Å

PDB Description: Full-length Replication protein A subunits RPA14 and RPA32
PDB Compounds: (B:) Replication protein A 32 kDa subunit

SCOP Domain Sequences for d2pi2b1:

Sequence, based on SEQRES records: (download)

>d2pi2b1 b.40.4.3 (B:44-171) Replication protein A 32 KDa subunit (RPA32) fragment {Human (Homo sapiens) [TaxId: 9606]}
qhivpctisqllsatlvdevfrignveisqvtivgiirhaekaptnivykiddmtaapmd
vrqwvdtddtssentvvppetyvkvaghlrsfqnkkslvafkimpledmneftthilevi
nahmvlsk

Sequence, based on observed residues (ATOM records): (download)

>d2pi2b1 b.40.4.3 (B:44-171) Replication protein A 32 KDa subunit (RPA32) fragment {Human (Homo sapiens) [TaxId: 9606]}
qhivpctisqllsatlvdevfrignveisqvtivgiirhaekaptnivykiddmtaapmd
vrqwvtvvppetyvkvaghlrsfqnkkslvafkimpledmneftthilevinahmvlsk

SCOP Domain Coordinates for d2pi2b1:

Click to download the PDB-style file with coordinates for d2pi2b1.
(The format of our PDB-style files is described here.)

Timeline for d2pi2b1: