Lineage for d2pi0c_ (2pi0 C:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1720410Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1721437Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1721974Family a.4.5.23: Interferon regulatory factor [46877] (4 proteins)
    Pfam PF00605
  6. 1721979Protein Interferon regulatory factor 3, IRF-3 [116791] (1 species)
  7. 1721980Species Human (Homo sapiens) [TaxId:9606] [116792] (3 PDB entries)
    Uniprot Q14653 3-112
  8. 1721983Domain d2pi0c_: 2pi0 C: [149491]
    automated match to d1t2ka_
    protein/DNA complex

Details for d2pi0c_

PDB Entry: 2pi0 (more details), 2.31 Å

PDB Description: Crystal Structure of IRF-3 bound to the PRDIII-I regulatory element of the human interferon-B enhancer
PDB Compounds: (C:) Interferon regulatory factor 3

SCOPe Domain Sequences for d2pi0c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pi0c_ a.4.5.23 (C:) Interferon regulatory factor 3, IRF-3 {Human (Homo sapiens) [TaxId: 9606]}
pkprilpwlvsqldlgqlegvawvnksrtrfripwkhglrqdaqqedfgifqawaeatga
yvpgrdkpdlptwkrnfrsalnrkeglrlaedrskdphdphkiyefv

SCOPe Domain Coordinates for d2pi0c_:

Click to download the PDB-style file with coordinates for d2pi0c_.
(The format of our PDB-style files is described here.)

Timeline for d2pi0c_: