SCOPe 2.07: Domain d2pi0b_: 2pi0 B:

Lineage for d2pi0b_ (2pi0 B:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.23: Interferon regulatory factor [46877] (4 proteins)
   Pfam PF00605

6. Protein Interferon regulatory factor 3, IRF-3 [116791] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [116792] (3 PDB entries)
   Uniprot Q14653 3-112

8. Domain d2pi0b_: 2pi0 B: [149490]
   automated match to d1t2ka_
   protein/DNA complex

Details for d2pi0b_

PDB Entry: 2pi0, 2.31 Å

PDB Description: Crystal Structure of IRF-3 bound to the PRDIII-I regulatory element of the human interferon-B enhancer

PDB Compounds: (B:) Interferon regulatory factor 3

SCOPe Domain Sequences for d2pi0b_:

Sequence; same for both SEQRES and ATOM records:

>d2pi0b_ a.4.5.23 (B:) Interferon regulatory factor 3, IRF-3 {Human (Homo sapiens) [TaxId: 9606]}
mgtpkprilpwlvsqldlgqlegvawvnksrtrfripwkhglrqdaqqedfgifqawaea
tgayvpgrdkpdlptwkrnfrsalnrkeglrlaedrskdphdphkiyefvns

Timeline for d2pi0b_:

• d2pi0b_ first appeared in SCOP 1.75, called d2pi0b1
  
• d2pi0b_ appears in SCOPe 2.06
  
• d2pi0b_ appears in the current release, SCOPe 2.08