![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) ![]() contains a small beta-sheet (wing) |
![]() | Family a.4.5.23: Interferon regulatory factor [46877] (4 proteins) Pfam PF00605 |
![]() | Protein Interferon regulatory factor 3, IRF-3 [116791] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [116792] (3 PDB entries) Uniprot Q14653 3-112 |
![]() | Domain d2pi0b_: 2pi0 B: [149490] automated match to d1t2ka_ protein/DNA complex |
PDB Entry: 2pi0 (more details), 2.31 Å
SCOPe Domain Sequences for d2pi0b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2pi0b_ a.4.5.23 (B:) Interferon regulatory factor 3, IRF-3 {Human (Homo sapiens) [TaxId: 9606]} mgtpkprilpwlvsqldlgqlegvawvnksrtrfripwkhglrqdaqqedfgifqawaea tgayvpgrdkpdlptwkrnfrsalnrkeglrlaedrskdphdphkiyefvns
Timeline for d2pi0b_: