![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.92: Chelatase-like [53799] (3 superfamilies) duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134 |
![]() | Superfamily c.92.2: 'Helical backbone' metal receptor [53807] (5 families) ![]() contains a long alpha helical insertion in the interdomain linker |
![]() | Family c.92.2.4: TM0189-like [142789] (4 proteins) Part of Pfam PF01497 that include some other superfamily members |
![]() | Protein Iron-uptake system-binding protein FeuA [159798] (1 species) |
![]() | Species Bacillus subtilis [TaxId:1423] [159799] (1 PDB entry) Uniprot P40409 39-315 |
![]() | Domain d2phza1: 2phz A:20-296 [149488] |
PDB Entry: 2phz (more details), 2.15 Å
SCOPe Domain Sequences for d2phza1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2phza1 c.92.2.4 (A:20-296) Iron-uptake system-binding protein FeuA {Bacillus subtilis [TaxId: 1423]} kkieyldktyevtvptdkiaitgsvesmedaklldvhpqgaisfsgkfpdmfkditdkae ptgekmepniekilemkpdvilastkfpektlqkistagttipvshissnwkenmmllaq ltgkekkakkiiadyeqdlkeiktkindkakdskalvirirqgniyiypeqvyfnstlyg dlglkapnevkaakaqelssleklsemnpdhifvqfsddenadkpdalkdleknpiwksl kavkedhvyvnsvdplaqggtawskvrflkaaaeklt
Timeline for d2phza1: