Lineage for d2phxb_ (2phx B:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2387948Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2387949Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2387950Family b.29.1.1: Legume lectins [49900] (5 proteins)
  6. 2388561Protein automated matches [190035] (28 species)
    not a true protein
  7. 2388562Species Bloodwood tree (Pterocarpus angolensis) [TaxId:182271] [186754] (21 PDB entries)
  8. 2388578Domain d2phxb_: 2phx B: [149487]
    automated match to d1n3oa_
    complexed with ca, man, mn

Details for d2phxb_

PDB Entry: 2phx (more details), 1.8 Å

PDB Description: pterocarpus angolensis lectin (pal) in complex with man-5
PDB Compounds: (B:) lectin

SCOPe Domain Sequences for d2phxb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2phxb_ b.29.1.1 (B:) automated matches {Bloodwood tree (Pterocarpus angolensis) [TaxId: 182271]}
edslsfgfptfpsdqknlifqgdaqiknnavqltktdsngnpvastvgrilfsaqvhlwe
ksssrvanfqsqfsfslksplsngadgiaffiappdttipsgsgggllglfapgtaqnts
anqviavefdtfyaqdsntwdpnyphigidvnsirsvktvkwdrrdgqslnvlvtfnpst
rnldvvatysdgtryevsyevdvrsvlpewvrvgfsaasgeqyqthtleswsftstllyt

SCOPe Domain Coordinates for d2phxb_:

Click to download the PDB-style file with coordinates for d2phxb_.
(The format of our PDB-style files is described here.)

Timeline for d2phxb_: