SCOP 1.75: Domain d2phwa1: 2phw A:1-240

Lineage for d2phwa1 (2phw A:1-240)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (25 families)

5. Family b.29.1.1: Legume lectins [49900] (4 proteins)

6. Protein Legume lectin [49904] (23 species)

7. Species Bloodwood tree (Pterocarpus angolensis) [TaxId:182271] [82032] (30 PDB entries)

8. Domain d2phwa1: 2phw A:1-240 [149484]
   automatically matched to d1q8oa_
   complexed with bma, ca, man, mn

Details for d2phwa1

PDB Entry: 2phw, 1.8 Å

PDB Description: pterocarpus angolensis lectin (pal) in complex with man-9

PDB Compounds: (A:) lectin

SCOP Domain Sequences for d2phwa1:

Sequence; same for both SEQRES and ATOM records:

>d2phwa1 b.29.1.1 (A:1-240) Legume lectin {Bloodwood tree (Pterocarpus angolensis) [TaxId: 182271]}
edslsfgfptfpsdqknlifqgdaqiknnavqltktdsngnpvastvgrilfsaqvhlwe
ksssrvanfqsqfsfslksplsngadgiaffiappdttipsgsgggllglfapgtaqnts
anqviavefdtfyaqdsntwdpnyphigidvnsirsvktvkwdrrdgqslnvlvtfnpst
rnldvvatysdgtryevsyevdvrsvlpewvrvgfsaasgeqyqthtleswsftstllyt

Timeline for d2phwa1:

• d2phwa1 is new in SCOP 1.75
  
• d2phwa1 is called d2phwa_ in SCOPe 2.01
  
• d2phwa1 appears in the current release, SCOPe 2.08, called d2phwa_