SCOPe 2.08: Domain d2phpe2: 2php E:241-420

Lineage for d2phpe2 (2php E:241-420)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.74: AraD/HMP-PK domain-like [53638] (1 superfamily)
   3 layers: a/b/a; mixed (mostly antiparallel) beta-sheet of 9 strands, order 432159876; left-handed crossover between strands 4 and 5

4. Superfamily c.74.1: AraD/HMP-PK domain-like [53639] (3 families)

5. Family c.74.1.2: Phosphomethylpyrimidine kinase C-terminal domain-like [159768] (2 proteins)
   automatically mapped to Pfam PF10120

6. Protein Uncharacterized protein MJ0236 [159771] (1 species)

7. Species Methanocaldococcus jannaschii [TaxId:2190] [159772] (1 PDB entry)
   Uniprot Q57688 241-420

8. Domain d2phpe2: 2php E:241-420 [149477]
   Other proteins in same PDB: d2phpa2, d2phpb3, d2phpb4, d2phpd3, d2phpd4, d2phpe3
   automated match to d2phpa1
   complexed with cl

Details for d2phpe2

PDB Entry: 2php, 2.03 Å

PDB Description: crystal structure of the c-terminal domain of protein mj0236 (y236_metja)

PDB Compounds: (E:) Uncharacterized protein MJ0236

SCOPe Domain Sequences for d2phpe2:

Sequence; same for both SEQRES and ATOM records:

>d2phpe2 c.74.1.2 (E:241-420) Uncharacterized protein MJ0236 {Methanocaldococcus jannaschii [TaxId: 2190]}
yinkekviknlsyaiyllkkmnftlipevgsniaeslpfpkdfkdvaaltgriiknklgg
fyivgdiefgasehiakiilsaskfnpeiracmnikydgglikllkdkfavssfdrkeep
pnvstmewgtkiacekfggvpdiiydrggegkepmirvlgrdaievvkkveviqkiyntl

Timeline for d2phpe2:

• d2phpe2 first appeared in SCOP 1.75, called d2phpe1
  
• d2phpe2 appears in SCOPe 2.07