Lineage for d2phpb1 (2php B:241-420)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 843699Fold c.74: AraD/HMP-PK domain-like [53638] (1 superfamily)
    3 layers: a/b/a; mixed (mostly antiparallel) beta-sheet of 9 strands, order 432159876; left-handed crossover between strands 4 and 5
  4. 843700Superfamily c.74.1: AraD/HMP-PK domain-like [53639] (2 families) (S)
  5. 843761Family c.74.1.2: Phosphomethylpyrimidine kinase C-terminal domain-like [159768] (2 proteins)
  6. 843766Protein Uncharacterized protein MJ0236 [159771] (1 species)
  7. 843767Species Methanocaldococcus jannaschii [TaxId:2190] [159772] (1 PDB entry)
    Uniprot Q57688 241-420
  8. 843769Domain d2phpb1: 2php B:241-420 [149475]
    automatically matched to 2PHP A:241-420
    complexed with cl

Details for d2phpb1

PDB Entry: 2php (more details), 2.03 Å

PDB Description: crystal structure of the c-terminal domain of protein mj0236 (y236_metja)
PDB Compounds: (B:) Uncharacterized protein MJ0236

SCOP Domain Sequences for d2phpb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2phpb1 c.74.1.2 (B:241-420) Uncharacterized protein MJ0236 {Methanocaldococcus jannaschii [TaxId: 2190]}
yinkekviknlsyaiyllkkmnftlipevgsniaeslpfpkdfkdvaaltgriiknklgg
fyivgdiefgasehiakiilsaskfnpeiracmnikydgglikllkdkfavssfdrkeep
pnvstmewgtkiacekfggvpdiiydrggegkepmirvlgrdaievvkkveviqkiyntl

SCOP Domain Coordinates for d2phpb1:

Click to download the PDB-style file with coordinates for d2phpb1.
(The format of our PDB-style files is described here.)

Timeline for d2phpb1: