Lineage for d2phpa1 (2php A:241-420)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2905490Fold c.74: AraD/HMP-PK domain-like [53638] (1 superfamily)
    3 layers: a/b/a; mixed (mostly antiparallel) beta-sheet of 9 strands, order 432159876; left-handed crossover between strands 4 and 5
  4. 2905491Superfamily c.74.1: AraD/HMP-PK domain-like [53639] (3 families) (S)
  5. 2905582Family c.74.1.2: Phosphomethylpyrimidine kinase C-terminal domain-like [159768] (2 proteins)
    automatically mapped to Pfam PF10120
  6. 2905587Protein Uncharacterized protein MJ0236 [159771] (1 species)
  7. 2905588Species Methanocaldococcus jannaschii [TaxId:2190] [159772] (1 PDB entry)
    Uniprot Q57688 241-420
  8. 2905589Domain d2phpa1: 2php A:241-420 [149474]
    Other proteins in same PDB: d2phpa2, d2phpb3, d2phpb4, d2phpd3, d2phpd4, d2phpe3
    complexed with cl

Details for d2phpa1

PDB Entry: 2php (more details), 2.03 Å

PDB Description: crystal structure of the c-terminal domain of protein mj0236 (y236_metja)
PDB Compounds: (A:) Uncharacterized protein MJ0236

SCOPe Domain Sequences for d2phpa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2phpa1 c.74.1.2 (A:241-420) Uncharacterized protein MJ0236 {Methanocaldococcus jannaschii [TaxId: 2190]}
yinkekviknlsyaiyllkkmnftlipevgsniaeslpfpkdfkdvaaltgriiknklgg
fyivgdiefgasehiakiilsaskfnpeiracmnikydgglikllkdkfavssfdrkeep
pnvstmewgtkiacekfggvpdiiydrggegkepmirvlgrdaievvkkveviqkiyntl

SCOPe Domain Coordinates for d2phpa1:

Click to download the PDB-style file with coordinates for d2phpa1.
(The format of our PDB-style files is described here.)

Timeline for d2phpa1: