Lineage for d2phfb_ (2phf B:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2387948Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2387949Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2387950Family b.29.1.1: Legume lectins [49900] (5 proteins)
  6. 2388561Protein automated matches [190035] (28 species)
    not a true protein
  7. 2388562Species Bloodwood tree (Pterocarpus angolensis) [TaxId:182271] [186754] (21 PDB entries)
  8. 2388590Domain d2phfb_: 2phf B: [149473]
    automated match to d1n3oa_
    complexed with bma, ca, man, mn

Details for d2phfb_

PDB Entry: 2phf (more details), 2.1 Å

PDB Description: pterocarpus angolensis lectin complexed with man-6
PDB Compounds: (B:) lectin

SCOPe Domain Sequences for d2phfb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2phfb_ b.29.1.1 (B:) automated matches {Bloodwood tree (Pterocarpus angolensis) [TaxId: 182271]}
edslsfgfptfpsdqknlifqgdaqiknnavqltktdsngnpvastvgrilfsaqvhlwe
ksssrvanfqsqfsfslksplsngadgiaffiappdttipsgsgggllglfapgtaqnts
anqviavefdtfyaqdsntwdpnyphigidvnsirsvktvkwdrrdgqslnvlvtfnpst
rnldvvatysdgtryevsyevdvrsvlpewvrvgfsaasgeqyqthtleswsftstllyt
a

SCOPe Domain Coordinates for d2phfb_:

Click to download the PDB-style file with coordinates for d2phfb_.
(The format of our PDB-style files is described here.)

Timeline for d2phfb_: