SCOPe 2.06: Domain d2phfa_: 2phf A:

Lineage for d2phfa_ (2phf A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.1: Legume lectins [49900] (5 proteins)

6. Protein automated matches [190035] (27 species)
   not a true protein

7. Species Bloodwood tree (Pterocarpus angolensis) [TaxId:182271] [186754] (21 PDB entries)

8. Domain d2phfa_: 2phf A: [149472]
   automated match to d1n3oa_
   complexed with ca, mn

Details for d2phfa_

PDB Entry: 2phf, 2.1 Å

PDB Description: pterocarpus angolensis lectin complexed with man-6

PDB Compounds: (A:) lectin

SCOPe Domain Sequences for d2phfa_:

Sequence; same for both SEQRES and ATOM records:

>d2phfa_ b.29.1.1 (A:) automated matches {Bloodwood tree (Pterocarpus angolensis) [TaxId: 182271]}
edslsfgfptfpsdqknlifqgdaqiknnavqltktdsngnpvastvgrilfsaqvhlwe
ksssrvanfqsqfsfslksplsngadgiaffiappdttipsgsgggllglfapgtaqnts
anqviavefdtfyaqdsntwdpnyphigidvnsirsvktvkwdrrdgqslnvlvtfnpst
rnldvvatysdgtryevsyevdvrsvlpewvrvgfsaasgeqyqthtleswsftstllyt
a

Timeline for d2phfa_:

• d2phfa_ first appeared in SCOP 1.75, called d2phfa1
  
• d2phfa_ appears in SCOPe 2.05
  
• d2phfa_ appears in SCOPe 2.07
  
• d2phfa_ appears in the current release, SCOPe 2.08