Lineage for d2phfa1 (2phf A:1-241)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 794080Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 794081Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (25 families) (S)
  5. 794082Family b.29.1.1: Legume lectins [49900] (4 protein domains)
  6. 794214Protein Legume lectin [49904] (23 species)
  7. 794218Species Bloodwood tree (Pterocarpus angolensis) [TaxId:182271] [82032] (30 PDB entries)
  8. 794259Domain d2phfa1: 2phf A:1-241 [149472]
    automatically matched to d1q8oa_
    complexed with bma, ca, man, mn

Details for d2phfa1

PDB Entry: 2phf (more details), 2.1 Å

PDB Description: pterocarpus angolensis lectin complexed with man-6
PDB Compounds: (A:) lectin

SCOP Domain Sequences for d2phfa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2phfa1 b.29.1.1 (A:1-241) Legume lectin {Bloodwood tree (Pterocarpus angolensis) [TaxId: 182271]}
edslsfgfptfpsdqknlifqgdaqiknnavqltktdsngnpvastvgrilfsaqvhlwe
ksssrvanfqsqfsfslksplsngadgiaffiappdttipsgsgggllglfapgtaqnts
anqviavefdtfyaqdsntwdpnyphigidvnsirsvktvkwdrrdgqslnvlvtfnpst
rnldvvatysdgtryevsyevdvrsvlpewvrvgfsaasgeqyqthtleswsftstllyt
a

SCOP Domain Coordinates for d2phfa1:

Click to download the PDB-style file with coordinates for d2phfa1.
(The format of our PDB-style files is described here.)

Timeline for d2phfa1: