![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.62: Cyclophilin-like [50890] (1 superfamily) barrel, closed; n=8, S=10; complex topology |
![]() | Superfamily b.62.1: Cyclophilin-like [50891] (5 families) ![]() |
![]() | Family b.62.1.4: PH0987 C-terminal domain-like [159249] (1 protein) lacks the N-terminal strand of cyclophilin but the beta-barrel (7,10) remains closed; corresponds to the C-terminal part of Pfam PF02682; Allophanate hydrolase subunit 1 (AHS1) |
![]() | Protein Uncharacterized protein PH0987 [159250] (1 species) |
![]() | Species Pyrococcus horikoshii [TaxId:53953] [159251] (1 PDB entry) Uniprot O58715 86-217 |
![]() | Domain d2phcb1: 2phc B:86-217 [149466] Other proteins in same PDB: d2phcb2 |
PDB Entry: 2phc (more details), 2.29 Å
SCOPe Domain Sequences for d2phcb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2phcb1 b.62.1.4 (B:86-217) Uncharacterized protein PH0987 {Pyrococcus horikoshii [TaxId: 53953]} ieipvayggefgpdiefvaqynglsvddvieihskplyrvyflgflpgfaylggmderia tprlekprlkvpagsvgiagkqtgwyaiespggwriigriplrtfnpgkvppsivlpgdy vkfvpidekefw
Timeline for d2phcb1: