SCOPe 2.08: Domain d2phcb1: 2phc B:86-217

Lineage for d2phcb1 (2phc B:86-217)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.62: Cyclophilin-like [50890] (1 superfamily)
   barrel, closed; n=8, S=10; complex topology

4. Superfamily b.62.1: Cyclophilin-like [50891] (5 families)

5. Family b.62.1.4: PH0987 C-terminal domain-like [159249] (1 protein)
   lacks the N-terminal strand of cyclophilin but the beta-barrel (7,10) remains closed; corresponds to the C-terminal part of Pfam PF02682; Allophanate hydrolase subunit 1 (AHS1)

6. Protein Uncharacterized protein PH0987 [159250] (1 species)

7. Species Pyrococcus horikoshii [TaxId:53953] [159251] (1 PDB entry)
   Uniprot O58715 86-217

8. Domain d2phcb1: 2phc B:86-217 [149466]
   Other proteins in same PDB: d2phcb2

Details for d2phcb1

PDB Entry: 2phc, 2.29 Å

PDB Description: crystal structure of conserved uncharacterized protein ph0987 from pyrococcus horikoshii

PDB Compounds: (B:) Uncharacterized protein PH0987

SCOPe Domain Sequences for d2phcb1:

Sequence; same for both SEQRES and ATOM records:

>d2phcb1 b.62.1.4 (B:86-217) Uncharacterized protein PH0987 {Pyrococcus horikoshii [TaxId: 53953]}
ieipvayggefgpdiefvaqynglsvddvieihskplyrvyflgflpgfaylggmderia
tprlekprlkvpagsvgiagkqtgwyaiespggwriigriplrtfnpgkvppsivlpgdy
vkfvpidekefw

Timeline for d2phcb1:

• d2phcb1 first appeared in SCOP 1.75
  
• d2phcb1 appears in SCOPe 2.07