Lineage for d2pgce_ (2pgc E:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2949708Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) (S)
    dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers
  5. 2950150Family d.58.4.23: Marine metagenome family DABB3 [160306] (1 protein)
    duplication: consists of two similar domains; forms a pentamer similar to the Chlorite dismutase-like pentamer and the MLI decamer
  6. 2950151Protein Uncharacterized protein GOS_2596953 [160307] (1 species)
  7. 2950152Species Environmental samples [TaxId:33858] [160308] (1 PDB entry)
  8. 2950157Domain d2pgce_: 2pgc E: [149461]
    automated match to d2pgca1
    complexed with cl

Details for d2pgce_

PDB Entry: 2pgc (more details), 2.53 Å

PDB Description: crystal structure of a a marine metagenome protein (jcvi_pep_1096685590403) from uncultured marine organism at 2.53 a resolution
PDB Compounds: (E:) Uncharacterized protein

SCOPe Domain Sequences for d2pgce_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pgce_ d.58.4.23 (E:) Uncharacterized protein GOS_2596953 {Environmental samples [TaxId: 33858]}
sninyviltvasvdfsyretmarlmssyskdlidnagakgtrfgsigtgdhagslifiqf
yddltgyqkaleiqskssvfkeimdsgkaniylrnistslptkfeqsyehpkyivltrae
aamsdkdkflncindtascfkdngaltlrfgnlltgsnvgnyllgvgypsmeaiektyde
llahssykelmtfakvnmrniikil

SCOPe Domain Coordinates for d2pgce_:

Click to download the PDB-style file with coordinates for d2pgce_.
(The format of our PDB-style files is described here.)

Timeline for d2pgce_: