SCOPe 2.05: Domain d2pgcd_: 2pgc D:

Lineage for d2pgcd_ (2pgc D:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families)
   dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers

5. Family d.58.4.23: Marine metagenome family DABB3 [160306] (1 protein)
   duplication: consists of two similar domains; forms a pentamer similar to the Chlorite dismutase-like pentamer and the MLI decamer

6. Protein Uncharacterized protein GOS_2596953 [160307] (1 species)

7. Species Environmental samples [TaxId:33858] [160308] (1 PDB entry)

8. Domain d2pgcd_: 2pgc D: [149460]
   automated match to d2pgca1
   complexed with cl

Details for d2pgcd_

PDB Entry: 2pgc, 2.53 Å

PDB Description: crystal structure of a a marine metagenome protein (jcvi_pep_1096685590403) from uncultured marine organism at 2.53 a resolution

PDB Compounds: (D:) Uncharacterized protein

SCOPe Domain Sequences for d2pgcd_:

Sequence; same for both SEQRES and ATOM records:

>d2pgcd_ d.58.4.23 (D:) Uncharacterized protein GOS_2596953 {Environmental samples}
sninyviltvasvdfsyretmarlmssyskdlidnagakgtrfgsigtgdhagslifiqf
yddltgyqkaleiqskssvfkeimdsgkaniylrnistslptkfeqsyehpkyivltrae
aamsdkdkflncindtascfkdngaltlrfgnlltgsnvgnyllgvgypsmeaiektyde
llahssykelmtfakvnmrniikil

Timeline for d2pgcd_:

• d2pgcd_ first appeared in SCOP 1.75, called d2pgcd1
  
• d2pgcd_ appears in SCOPe 2.04
  
• d2pgcd_ appears in SCOPe 2.06
  
• d2pgcd_ appears in the current release, SCOPe 2.08