SCOPe 2.06: Domain d2pg4b_: 2pg4 B:

Lineage for d2pg4b_ (2pg4 B:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.48: F93-like [109674] (4 proteins)
   contains long helix in the C-terminal extension; forms dimer similar to the RTP and LysR dimers

6. Protein Uncharacterized protein APE0880.1 [158290] (1 species)

7. Species Aeropyrum pernix [TaxId:56636] [158291] (1 PDB entry)
   Uniprot Q9YDN4 1-92

8. Domain d2pg4b_: 2pg4 B: [149456]
   automated match to d2pg4a1
   complexed with cit, cl, edo, peg

Details for d2pg4b_

PDB Entry: 2pg4, 2.21 Å

PDB Description: crystal structure of a putative dna binding protein (ape_0880a) from aeropyrum pernix k1 at 2.21 a resolution

PDB Compounds: (B:) Uncharacterized protein

SCOPe Domain Sequences for d2pg4b_:

Sequence; same for both SEQRES and ATOM records:

>d2pg4b_ a.4.5.48 (B:) Uncharacterized protein APE0880.1 {Aeropyrum pernix [TaxId: 56636]}
detlrlqfghlirilptllefekkgyepslaeivkasgvsektffmglkdrliraglvke
etlsyrvktlkltekgrrlaeclekcrdvlg

Timeline for d2pg4b_:

• d2pg4b_ first appeared in SCOP 1.75, called d2pg4b1
  
• d2pg4b_ appears in SCOPe 2.05
  
• d2pg4b_ appears in SCOPe 2.07
  
• d2pg4b_ appears in the current release, SCOPe 2.08