Lineage for d2pg3a1 (2pg3 A:1-230)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2468308Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2469527Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families) (S)
    share similar mode of ligand (Adenosine group) binding
    can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group
  5. 2469528Family c.26.2.1: N-type ATP pyrophosphatases [52403] (9 proteins)
  6. 2469652Protein Queuosine biosynthesis protein QueC [159496] (1 species)
  7. 2469653Species Erwinia carotovora [TaxId:554] [159497] (1 PDB entry)
    Uniprot Q6D820 1-230
  8. 2469654Domain d2pg3a1: 2pg3 A:1-230 [149454]
    complexed with zn

Details for d2pg3a1

PDB Entry: 2pg3 (more details), 2.4 Å

PDB Description: crystal structure of a queuosine biosynthesis protein quec (eca1155) from erwinia carotovora subsp. atroseptica scri1043 at 2.40 a resolution
PDB Compounds: (A:) Queuosine biosynthesis protein queC

SCOPe Domain Sequences for d2pg3a1:

Sequence, based on SEQRES records: (download)

>d2pg3a1 c.26.2.1 (A:1-230) Queuosine biosynthesis protein QueC {Erwinia carotovora [TaxId: 554]}
mkravvvfsggqdsttcliqalqdyddvhcitfdygqrhraeievaqelsqklgaaahkv
ldvgllnelatssltrdsipvpdydanaqgipntfvpgrnilfltlasiyayqvgaeavi
tgvcetdfsgypdcrdefvkalnqaivlgiardirfetplmwlnkaetwaladyyqqldt
vryhtltcyngikgdgcgqcaachlranglaqyqkdaatvmaslkqkvgl

Sequence, based on observed residues (ATOM records): (download)

>d2pg3a1 c.26.2.1 (A:1-230) Queuosine biosynthesis protein QueC {Erwinia carotovora [TaxId: 554]}
mkravvvfsggqdsttcliqalqdyddvhcitfdygqrhraeievaqelsqklgaaahkv
ldvgllnelatssltrdsipvpdntfvpgrnilfltlasiyayqvgaeavitgvcetdfs
gypdcrdefvkalnqaivlgiardirfetplmwlnkaetwaladyyqqldtvryhtltcy
ngikgdgcgqcaachlranglaqyqkdaatvmaslkqkvgl

SCOPe Domain Coordinates for d2pg3a1:

Click to download the PDB-style file with coordinates for d2pg3a1.
(The format of our PDB-style files is described here.)

Timeline for d2pg3a1: